SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_013310 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_013310
Domain Number 1 Region: 399-662
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-77
Family Protein kinases, catalytic subunit 0.0000616
Further Details:      
 
Domain Number 2 Region: 175-245
Classification Level Classification E-value
Superfamily E set domains 0.000000000151
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_013310
Sequence length 695
Comment | organism=Entamoeba_invadens_IP1 | product=tyrosine protein kinase, putative | location=EINV_74:87092-89225(+) | length=695
Sequence
MILLNLSFLFFHVILSLVKSGVVLKTTTFIISSKTVQECVDTQCTSSMNFKDYFECSNVD
YNQSIFTTVFTLSIPESVTSMNSTFLLTTKKNLDRYSPPSFMSISVNGEELRLGELSHEY
TTADDSCCFSNYSIFTQTSFFRSGKNVISITPQTNIVCLSSFQITVQYYLHLPDIFDVTP
TAGPISGGTHVTIYAADIDKEQTYFCFFGNEKSLFTATSSNTGNCTTPKIESVGNVSFYL
GFSAEDPKPTTTQNFTFYDITITDANFEKYEGNSIIRITGSGFINTKTLLCFIQKQRDSP
NATLSSFREDYNVLNFTAEFIDTSHVACQVTDINEGKYLIGLSLNTADIVWSNSAVYYSK
SHIDSRWIVLLVILVVIIFFVVVLTGLGIFIRKKKQNTIEIVQNISTREIVCEEIIGKGS
FGDVWSATWKGQEIAVKLIPLEKVQKGKLKQTMKEVELMSSLRHPCVLQFFGSGMDEKFL
LIAMELMTNGTAREILDNSMIELYWEKRLRMLKDCASGMVYLHHCKPPIIHRDLKTNNLL
VDDNWCVKVSDFGLSVPLYGEEINPTAICGTLSWMAPEALLNKPYGTKIDVYSFGIVLWE
FLTRKRPYGKMDPHEILTKVSQKGMRPDIPKDECEVKGYVNFMQMCWEESPENRPTFDQI
VDKISEMIDEMDNLDKSKEEDEEVEEEGDERTPLI
Download sequence
Identical sequences XP_004257170.1.21224 jCVI|EIN_013310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]