SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_014480 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_014480
Domain Number - Region: 31-114
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00314
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_014480
Sequence length 360
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_74:331341-332423(-) | length=360
Sequence
MEETINSLILKQYVFERYLDNRQSADLYVLDEVKKVSAVQVTLNETVESSSKTIEQLQKE
TQRLTTENNALKQMVGTLESQIAAKTKAEVESSDAIKHLTDRLVALEQLVHSLSTTSTFG
AKEVTHEIVKEKAKPFEHHEEPHVELIEPQKPTAVVQEPEKVVVKPSEKTTTATVISELK
KEEEPKGVEEILDTPFDKTVIDAIEKMAEKKVVDTFYKGTDEGFSAEEFNRCVGSNKKVL
VIVKTTKNDIFGGYCSEFPIVDDVAKGVFGDKEHFVFRVKDGKATKYMKRDNSSYSTWAF
PDDSENILSFAGAFVISGNCKANEESRISGNFSRDYVDNGEKLCSTPTFAVDEMVALQMN
Download sequence
Identical sequences XP_004257289.1.21224 jCVI|EIN_014480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]