SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_014620 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_014620
Domain Number 1 Region: 553-743
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000107
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_014620
Domain Number - Region: 52-132
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_014620
Sequence length 864
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_74:354372-357067(+) | length=864
Sequence
MASLQNEQQVEDEGYLENSMESSDSSESPKISKTTNSTGTSQATSTESDSNSTSTTDSIE
QLQEIVDAMQVQIRNYKQTLLETQNQLHLQITDLQNKNAELVRKSSDKDDKLFKAADTVK
SLIGELKEMTDKNTSLHCEILKDKDDLAALYKRLGQLENTSHVGNLNELEVSLVLKLERN
KVVSADVLTKSADEQKKDLKLQIEILEKNLMMSKSDILALKSSNGDLTQELSKKNDENQN
VKQKNEELSESNKTLNLQINKLTDELSKIRNVKKKTISIKGESNEDISMKEAALEVIRKI
NNSQTKIFDQPIYDEFALFQKQNNFTPNTFAHVQQKCYETLKDDLDKFMKSSSLITVQKA
TDYIDIYKEVSSRTYFTTFVKTHSPNLLKYHNVLADVINFNSKFGKKTVKRSPTPGIENN
QPQLIQRQRKRRPTISIADDLQEDGLNFSAFKERKQVPLTVSDSFITRKNKGSPEILSES
GETPDKVFKSEESMDSEENKEYTDHYKNFKTKMLCWTGKELWAFKEQNAGKTAVGIYTNF
SKEVPQQIFNIVGEVISVVYLDSNVFVAKTDNSVTAYNIASKIGKNIIDTSDSNIAHMES
CERKVLVFVEGKFYYEINERLEKTVRKLSLLSDIKTVAICGENLWVGTLAGLNVFNTFKK
KSKIVKGIPKGEISQLLHANEKVWVVLNDDINVVDVETHDVVKVLSLPVQKLKLIGKFVW
ILLRNGSVKVYDSQTLELKTEHSISRFTLYDAVPTFKPKLDNTEKEMKEWVCVLCGEENK
LFQVGTPFPFHDWCVIENQSGTKTCRCCSKKFKSGGVFCHKCCAVFICDKCRGNPEVFSL
ITNTDTCSEYSALKAEFIKKEKKK
Download sequence
Identical sequences XP_004257304.1.21224 jCVI|EIN_014620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]