SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_025010 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_025010
Domain Number 1 Region: 99-221
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000759
Family Myosin rod fragments 0.0024
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_025010
Domain Number - Region: 336-447
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000366
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_025010
Sequence length 534
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-6, putative | location=EINV_97:99312-101987(-) | length=534
Sequence
MPLQELQLPQPWSQFSTRPNEQGHCISVGVLAEIEEIRENRVTEIVGGLHVCAKAISQRK
LIEWKLDEQIVIIVIQDTIHIWYHFRNWVWFRLFQKVRPILKKRRVDEEFAAKDKEIEAL
KKKLAEEIAKSEAVEKALSEMKIKNIDLETLKESVITELNKDIEDKEGEISDLKKKLEAE
EDNSKDLETQLHEKENIIADLEKQVKKLQNTISGVNAQNEDTGTKDKLEADAENTNGKKY
VQEKQLSQLKADNDNLTKAKFVVDAKLEDAEREKAALNEENFDYLKKNADTDAADKKKLN
GTVNKSNKKIEELSAKVDELTGVITKIEQEVVEANEELETVKXXKEIKAKKLKTENDEIK
KNVKNLANDKNQLSSEKKKLQDEYDQLNNLVSAHEEETNNLNGSIKKLQRDLEANNTELT
ELRDKTTKDKKKIANLEQKVQDLEDRPRDNQIVDLEKAVAALKDQNTQLDAAKNYMKKQS
VEDASKIENYESQIKALEAQKKMALDNKTDDEKIAADQSDRRKKMEDQVKALNA
Download sequence
Identical sequences jCVI|EIN_025010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]