SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_026710 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_026710
Domain Number 1 Region: 181-578
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.77e-85
Family Amylase, catalytic domain 0.0000441
Further Details:      
 
Domain Number 2 Region: 583-677
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.3e-20
Family alpha-Amylases, C-terminal beta-sheet domain 0.0038
Further Details:      
 
Domain Number 3 Region: 44-152
Classification Level Classification E-value
Superfamily E set domains 0.00000000000022
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_026710
Sequence length 680
Comment | organism=Entamoeba_invadens_IP1 | product=1,4-alpha-glucan-branching enzyme, putative | location=EINV_99:176720-178762(+) | length=680
Sequence
MSKLQVLIDDPSLNEFAPTIVGRQKKTYDLLSRIEASEGSLEQFADSYKRYGLVRGTENQ
NGKDVEGWVFREWAPNFKEMYLFGDYNNWDRNTAYKMHRDEFGTHSGFIADVNGKSVIPH
MSKIKFYGITHQGERLDRIPTYHRYCVINKKMSCMEAVVYNPENPYKFTAQRPGIPEALK
IYESHVGICTPDTKIATYDDFRERIVPYCKNVGYNAIQLMAIMEHPYYASFGYQVTNFFA
PSSRFGTPDQLKRLIDECHRQGIVVLLDIVHSHTSSNVVDGINNFDGSDAHYLLPGDHGR
HPLWGSRLFNYNNYETIRFLLSNVRYYAEEFQFDGFRFDGVTSMIYTHHGVGGCTFDYKN
FYGPCANEDALSYLSLVNILVHRKDMHCVTIAEDVSGYAGLCRTVEDGGVGFDYRLAMSC
PDLWVEYLKTKKDEDWNVNHIGFTLNNRRWKEKCIAYAECHDQALVGDKTISFWLMDKEM
YTGMSQVWAPSFIISRGIALHKMIRLVTCMLGGEGYLTFMGNEFGHPEWLDFPREGNGDS
FHYARRQYNLVEDKLLRYKNLLAFERSMFALEKEHPWLCKQNAFISKHNEADYVLAFQRG
DCIAVFNFNPNKSFTDYGVGVKEPGKYKIVLSSDDKEFDGFGNAVSGGELFTENMSCDGL
PYMVKVYIPTRVVIVLVKIN
Download sequence
Identical sequences A0A0A1TZ94
XP_004253645.1.21224 jCVI|EIN_026710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]