SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_029070 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_029070
Domain Number - Region: 20-79
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_029070
Sequence length 116
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_107:117473-117823(-) | length=116
Sequence
MATPVNVTIPLEDYITLRLVHNQLETARKQHKILLEERVKKRKEIEDIQLKLESKRKEIQ
TTTRELASLRGECEIEKQKIILISKMPRPLELHHKKQKKLVRNDKTSKIVTEKETN
Download sequence
Identical sequences A0A0A1UDB6
XP_004261210.1.21224 jCVI|EIN_029070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]