SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_034820 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_034820
Domain Number - Region: 390-505
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00589
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 
Domain Number - Region: 12-99
Classification Level Classification E-value
Superfamily E set domains 0.0133
Family Arrestin/Vps26-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_034820
Sequence length 589
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_137:356881-358650(-) | length=589
Sequence
MNVDYQIERGGFAGKKMQGTVTLNCTSSFLVKTIFLKITKIVSTQNRNKDVIEYSIFPLR
VYFYSHEFCPGISQVFFECEIPLTFPLMFVSDKVGLKYYGECVVTTSNTTEFKSRPKIFP
VLFDQRKLLKQSKAVNKEMNGYIVSMHSSQIVYHKDKTVRLYFNACRLKADQADETFYFK
LMQQTKVGNTNPMTEILSTTQFKTPIKSVENVPLVFTPTEKCCPSVEDSFVSLYHFVVLS
LQEDSFESTEDNLWFPIYVSGWKPKSVSYDLRRYIKQIDLQIDPSIFSDERIKREVPHIP
DGMYSKDGTEVVMLSDNTHIKLDHFNRRVLGMDNIPIDMVYPSFDSFLLNNGLTFGLYKN
REIVVDHVAGCAKFTDQVDEVPQAVKVGSTTAVLTLVIEQTEGIQCQDMSSIGDVTCAVY
VDEFSDLKNKRNIQESYSIDEQTMSFKNTKFVIDVSQRLNVIVSFIRTTREKREIIGFVD
LKLSHIPFPSLVEKWFDFMPSPLGEEFYIGRVKMKIGYDTKAHTQLDHFVVLPDYFSMFC
VPEYVLTEATISLIEIQKLFCDKRKLHNQCVVVNGDVRLIRQLKFLHVI
Download sequence
Identical sequences XP_004259932.1.21224 jCVI|EIN_034820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]