SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_038290 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_038290
Domain Number 1 Region: 27-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.34e-88
Family Motor proteins 0.00000691
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_038290
Domain Number - Region: 400-466
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0248
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_038290
Sequence length 484
Comment | organism=Entamoeba_invadens_IP1 | product=kinesin heavy chain isoform 5C, putative | location=EINV_137:1076458-1078010(+) | length=484
Sequence
MNHIFVLLSFEDFQRKLRKNRTMQQIVEVGVRVRPANKNEVTSSCCEVDEKRSVIINNSP
REECHFDFVGDEKMTQRSLFERVGVSIVDSCLSGSAATLFAYGQTGSGKTFTVFGDYDHK
QQQIHNVGLVPRCLELLFQKKQRNLEVGISMFEVYNDIFFDLMKDGEKCDVKSDLKGTVG
VNGLAMVRCTSWEEALTFTVKGYSFRKTSTTKMNDQSSRSHCVTLISVGRGTMIFVDLAG
SERVERSGVTGLAKIEAGNINKTLTALGRVIRSLVAHDSHIPFRDCKLTTVLENAMVQSQ
RICFIATISSSVSNAVETWGTVNFAKNTKQMKIRVVRKTQELTYDELKMENIKLKTENQV
LKNELNSRKRADPSPDNFQFHKIMVQTKEMKHMILNNPSVDALTGEKNALSEDLREARNR
IKELEIMCEEKDLQIANLLQTEKDFQDQIDEKNEELVGMEECARDTQKRFSVCAMNTSTS
GLLL
Download sequence
Identical sequences XP_004260278.1.21224 jCVI|EIN_038290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]