SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_039810 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_039810
Domain Number 1 Region: 79-160
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000242
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 14-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000622
Family Ubiquitin-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_039810
Sequence length 193
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_148:22690-23271(+) | length=193
Sequence
MKIENYSEGTFDSFDITISLEQTVDDVKHEISIFKHIEKEALCIVYNGDVLTDDVVLSTK
GITLSSKLRYFVSHCNLQVESIYPVQGYTSGGTRVTIQGNFPGSQEKYTVRFGVTDVVGQ
YVDEKTVVAFSPAHPPGPVTVTIKIGDNGRYAHSDILFSYFNTIVQSDNIEVKCVDKISD
KMYADKFASGGVC
Download sequence
Identical sequences A0A0A1TV56
jCVI|EIN_039810 XP_004183560.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]