SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_040960 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_040960
Domain Number 1 Region: 558-567,594-823
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000114
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_040960
Domain Number - Region: 824-860
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000576
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.023
Further Details:      
 
Domain Number - Region: 100-212
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0196
Family Myosin rod fragments 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_040960
Sequence length 904
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_148:262549-265474(-) | length=904
Sequence
MKHLSTPTPLQGSPRSSKKITASQTNPEKSDHPENNNKTETFLPSLSSSESQSASYSSTE
KSKTSHSSSSKYSKTSKGSKSSKASKTSEDSSAGTSASDSSQGLQEIIDLMQSKIAEYKQ
LLDSTRNQYTEQITVLTKERNQLNSQLTDNNSKLLKAADTIKTMFNDLKDLTATNKKLSD
QKIKDSEDLAALYSRLGQLENSGNKESLNELELSVVLKLERNEVIKAEVVKKNLDEQKRD
LKLSIQVLEKNLMQSKSENLNLRTENDTLNRKLSNKNDLESLCEKLKKEKMDVEAKLAEQ
ISKLKTPKKGILSFKGESNDVNTNNVQMKDEALALINKFTTVVPHGIFDTATYEEFNLIQ
KHNMYHPYMFTHIQAQCYAKLKETIDSFVKVSTLETVKRITSYEDIYKEVSTRAYFATFM
KKVAPHLHVYHNVMVDVIQFSMKFDKKSKTTLAGHTQKKSLAFIPATVSTSEQATNVMNN
QILRRRRPTMIGDMPKYSNFSLLTQKLSKVTEPKECPSALSAQSPLSTGMKEETKEEMKD
DYSEENNDKIRTKFVCWTGKELWAFKDVVNGETVVYSYVPRQIDKYINKFSVIGEVVDVI
GVNEFVCVAKRDNSIDVLYRDTRELKTNFQLEEGGSIIEMFKAKSKVLVLTAKKVLYTLD
IKNEKKKAEDVLSPCEIRSGTIVEGKKRMMCITGEVSKVVRGLNSIWAVYTNQIFVLDID
NATIKKTIPINPTKIKLIGKQMWVLQHDGTVNVYDCESLELVANHVLTKSVLFDVTEVFL
SNENIKQRSSNKKEWICVVSSESDGLIIVQTSNMCHDWIPVDPKDTTTHTCYTCDKKFSK
GGLTCKNCKRVYFCDKCSNNVDLVKDVMETEICLHLNKRSGKPRLSRSIKASDEKKEIEK
MEKK
Download sequence
Identical sequences A0A0A1TXP9
jCVI|EIN_040960 XP_004183666.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]