SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_044600 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_044600
Domain Number - Region: 9-76
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0107
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 93-132
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0183
Family Moesin tail domain 0.011
Further Details:      
 
Domain Number - Region: 109-174
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0549
Family Clostridium neurotoxins, "coiled-coil" domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_044600
Sequence length 196
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_166:34846-35572(-) | length=196
Sequence
MTKTYFFLKKKKLQYEYDQLINLVSGHEDETNNLNGSIKKLQRDLEANNTELTELRDRKD
KNKIADLEQQVQDLEDRPVGTSNIDQTEVIKRDNQIAYLENEVAALKDQNTQLDAAKKNM
KSGLSKTQTLNAQVSSLKVQVSAPASVAQEEEKNMLNARIAEIQAQLDEERQKADSADVA
RKVLREIITKSPVQLK
Download sequence
Identical sequences L7FK05
XP_004183138.1.21224 jCVI|EIN_044600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]