SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_048390 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_048390
Domain Number - Region: 8-111
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0112
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 169-265
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0196
Family Fibrinogen coiled-coil and central regions 0.0094
Further Details:      
 
Domain Number - Region: 393-440
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_048390
Sequence length 468
Comment | organism=Entamoeba_invadens_IP1 | product=coiled-coil domain-containing protein, putative | location=EINV_183:14041-16040(+) | length=468
Sequence
MKSQEDEEHIEELQGNIKRGKEDLGKLTTEYKKLEADNQRLQNEITEHKATIAQRDSVIT
ELNKDIEDKEGEISDLKKLEAKEDNSKDLETQLHEKEDDIVDLEKHVKMLQNTISDVNAQ
KENSGATQLALDDTEKKLDQQVAQNKKVSNERDGYNQQLQAEKTKTTALTSAKNASDKKI
SSLNSEKDELEDKNRKLAELVKRIEDVENYKNDLGRTKAELDQLQQNFDYLKKNADTDAA
DKKKLNGTVNKSNNKIEELSAKVDELTGVITRREQEVAEANEEFETVKKDKFVKEKEAKK
LKVENDEIKEKLQRDLEANNTELTELRDRTAKDKKKIADLEQQVQDLEYRPVGTSNIDQT
EVIKEDDIADLEKAKNMKKWSVEDASKIENYESHIKALEVQKKMALDDKAKAEKTAADQS
DRRKKMEDQVKALNAQVSSLKVQISAPASVAQEEEKNMLNARIAEIQA
Download sequence
Identical sequences A0A0A1TW98
XP_004184118.1.21224 jCVI|EIN_048390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]