SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_048400 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_048400
Domain Number - Region: 33-91
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_048400
Sequence length 100
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_183:16125-16427(+) | length=100
Sequence
MKQKPDKETQRLRAKVTNSEAKLVDETGATGASIAKLKAKYETEFKGIETERKKHKTRPL
KPRNNINSMPERLKRLRESLQNSNRRSIQLKLKLVRHKPI
Download sequence
Identical sequences A0A0A1TW73
jCVI|EIN_048400 XP_004184119.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]