SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_049650 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_049650
Domain Number 1 Region: 77-184
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000349
Family Tropomyosin 0.0052
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_049650
Domain Number - Region: 191-300
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000523
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 9-73
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number - Region: 348-394
Classification Level Classification E-value
Superfamily Tropomyosin 0.0327
Family Tropomyosin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_049650
Sequence length 418
Comment | organism=Entamoeba_invadens_IP1 | product=leucine-rich repeat-containing protein C10orf80, putative | location=EINV_185:161448-163047(-) | length=418
Sequence
MNKVSDDKDGYNQQLQAVKTKTAALTSAKNASDKKILSLNSEKDELEDKNRKLDSSNKDA
QRKLAELTKRIEDGLNDSDKDAQEKQLSQLKADNDNLTKAKSVVDAKLKDTEREKAALNE
EVEAANEKLRITKNDLGRTKAELDQLQQDFDYLKKNADTDVADKKKLNGTVNESNKKIEE
LKVAEADEELKTVKKDKFAKEKEAKKLKAENDEIKEKVKNLAYDKDLLSSEKKKLEDEYD
QLINLVYKHEDETNNLNGSIKKLQKDLEANNTEFTELRDRTAKDKKKIADLEQQLQDLEY
RPRDNQIADLEKAVAALKEQNTQLDAAKKDMKKQSVEDATKIENNGSHIKALEAQKKMAL
DDKAEAEKTAADQSDRRKKMEDQVKTLNAQVSSLKVQVSPPASVAQKEKNNMLNAIIT
Download sequence
Identical sequences A0A0A1TUD6
XP_004182942.1.21224 jCVI|EIN_049650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]