SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_051280 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_051280
Domain Number - Region: 127-194
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0759
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_051280
Sequence length 288
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_188:300801-301667(+) | length=288
Sequence
MSLTDAEKTKLQQISSKKYKEQAIWFLNAYWAENGEAVAEKVWDVCNKFAEFDQENKAEG
CSLDEMNIHRILEFYQSQQTIQQFRESLRSQQFEVKKLYALGVYLSWNYKLTLKKFVNAP
QGAQSAEMAKAQEMVDQVGKLLEEANAKATEATKKDKELETALNALKKEETDFNNKTEEL
KQRIEKETGVVKKNRAQAELAQHLESDPLPLRKAKITCEAAKKKSEKARKEAEDAAEEMR
KKMEEAEAYLNEQKAAASAGMGLMWWMQRELTEKKKYMPTRKGGVAKK
Download sequence
Identical sequences S0B1T8
jCVI|EIN_051280 XP_004184458.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]