SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_052480 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_052480
Domain Number 1 Region: 357-394
Classification Level Classification E-value
Superfamily WW domain 0.0000000858
Family WW domain 0.0034
Further Details:      
 
Domain Number 2 Region: 11-131
Classification Level Classification E-value
Superfamily E set domains 0.000000357
Family Arrestin/Vps26-like 0.028
Further Details:      
 
Domain Number 3 Region: 402-504
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000491
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_052480
Sequence length 871
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_188:556685-559300(-) | length=871
Sequence
MSVSISFHYINKAYVVGDCIQGFISITTKRRAILTSLYFNIYGKTITIPNINNSKPQKEY
TQFFISSNFPPLAEQWNSSNGPFCREYPIGVHVVPFSIQVPSVPSPSVTLKNGIGIKYFL
QATLTVLTLKKDDSKTQLSTFSEESEIQIISFKKQTLEQNVTFKEEKTNSFGLFLKLSCN
TSVVPNQPLKVTAFIKNTTGNLVSPVLMWHSEHQYKETYLVLNGGVRHLGDVETITEKEV
TIDTSNLFPTISQKNFSIRSFLELQISYSKSTIVCRLELNVGWEMVSVDVNRARGALLGV
EYISDKMAFYGAHMRPTPECDETVEKKVFENKVYYVNHLLRKCYSDSKCLSITNARYPLP
ECEKLPYGWGIGSDRGEIYFINWNKKYTTWIDPRPFPNRKVVVRNISVTLFKGRNFPALK
GKVCTSYCVVFDSENRAIQSGSSTKCVDPIWSENNTLTFSNSPDRENFVLYFYTNKKFVG
GIDLPMWRIADNGIMEWFQLRNFGDFEIPQTGEVLLKICWEGDTQPVEKECVLAHFPPFY
CNSPATKDQEKYINKYRKKNKELPEEFKVSGDLVTGKNVFFLEVGISENTFVLGHAVNYD
ANWVGKDLDKSPFLSSTDCQRREKRMASLSAASTPLKLNNTKTLLSLQRSTPLHRPQRSL
TGSLSRKAEDEDLEEVMGALTDRQSVYLRNRNNSMSEKPCNLGDSPLMLVDDKSEEQFAP
LSKEVFQEVVMDREDILSRRKRLLDEEKSKAMDELLHIEQTQHSPRRNELKRESEGILSP
RSPVISPRSLQNSSSLSPRGGAHSPPNNTPRNIIVISCESQKLKSERCEKRVSSLLKKSE
SDKSFESHVASLGVVDEVEFSPSEKRLLGLV
Download sequence
Identical sequences jCVI|EIN_052480 XP_004184575.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]