SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_053060 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_053060
Domain Number - Region: 554-660
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000107
Family Myosin rod fragments 0.003
Further Details:      
 
Domain Number - Region: 727-822
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0128
Family Myosin rod fragments 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_053060
Sequence length 1001
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_188:677813-680818(-) | length=1001
Sequence
MSRIQLGKNRRTRAGVTQPVAEPEPQFTRTTTTTKEEDDTEPQLDDEEEEEKRRILETLA
KQNNKNKQPEQPKEDVPQEPPKEEIKEEISTEKGQEEPLRKSNFLNRRMSRAGSGKRFTT
DSTETPAKAEDSPVEKEAEPHKEKEKDKSGKDKKERRLSFFQKMKGKKDKKKEDDTSAGT
DSKTEEQTTEEDTLPFNDEAFKSFQEEIDKLKKQVEDQDVSIMVKTKKEESLNKTIAELN
DEKTRLLKISEVKDARVSELEESLKKVEEEKIKMREDKANCNEGMEKVAEELESVKKEKQ
ASDETNEKNLKTLNLKIEELKQSIAEKDEENTKMNERIDILTKEKETNLTTFDEVSKEVE
SLKTQLEKVNQENTQQNEKMKNDFEIEKQNLLKQITDGKEEITKSNEDIQNLQSEKNKIQ
EEMKEQVDKNNKLEKQIEDQKEQIKTLEDKVEKVENEKAKVMSDMANGSDGMQKLNEELE
KVNLEKHTLEQQNSEKDKTIKSVNLQIEELNIKIQQQEEEFQKVTAEKVNFETQITALTQ
KIAGGDSSAVLLKNQIEALNEENKKLKEEISDLKTKVSGFVSESSILNAELDKLRAENSR
LSDQLSQHKDVKDSLVQSEENINKLKEQLKSLEKELTESENAKKSLEEENSSLNDEIEKL
SNDKRTNNTDNIQQVLTLKKENQHLSTSLEQKKDEVSQLQEKIEGFEGMVALLKTQLEKS
KVDTQELTSLSEENIAKEQEVTTLKEKIDDLEKQLRTVKSRANSDQTVSRIQNTRSGMNN
TIEDLRQKQSELEKANWDLKDTINELNNKLSDKEQLIENLKDNNQSVIGKTESEKKNLED
TLNERTTELESLKERLEKEIMEKKHIQDDYNDYVRKEIGESGSVGEPGEDEARENEIAVR
QLRVENTKLRCSVDTLSEQVMSKQNLLQQRDDKIMKSLEYHYFEAVWTALKMQVIEYGGS
KSMLKRVAENPLFLFKKCYQENSFDRYNEWVVKYAKGQITK
Download sequence
Identical sequences jCVI|EIN_053060 XP_004184635.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]