SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_053330 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_053330
Domain Number 1 Region: 18-140
Classification Level Classification E-value
Superfamily E set domains 0.000000000455
Family ML domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_053330
Sequence length 142
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_188:728922-729350(-) | length=142
Sequence
MTALFISSLFLLAVYSSQVTYTTCSNNQKLVVNSIEAIPWPPESGVTIIITMNITTSEKV
ETLMLENVLESKYGMFWVELSTTKNNLCDTTIDCPILGNKTFKMAMEIPPMTPTNSQWRA
TLSFKREENKIGCVRLDPFVVS
Download sequence
Identical sequences jCVI|EIN_053330 XP_004184663.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]