SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_053760 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_053760
Domain Number - Region: 381-427
Classification Level Classification E-value
Superfamily E set domains 0.0301
Family Filamin repeat (rod domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_053760
Sequence length 434
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_188:811610-812914(+) | length=434
Sequence
MLRRSRRSTVFPHITWNNTQIKITADDIIKSELYVNGAAPVTIQCERDGVYSEQQIFIEK
AVKVDDILKEWNTQNRRETQLGYLTGLYEVTIVQSSSVCYLTVTPGKLDASKSELEEPKP
SKHYVGDSLFIKYKPRDQFDNVIEYNTLTCVITNKATEQGFTLTLLNIEHGFFGSPIPVL
TRQGFYSLQIKNSEDVLVESGFTLQAGEIEPKNCFLYQEVEVKSGDKVTRVQRKVDSSLR
QIVRRDYTIYLLLADKYNNVIKDLNNNVPISLSRSKTLTCKNDGCTFTLSSMEAGSYFFD
CRLIVGQKKVSVNGCPLQNLCFDEIDFDQLQPSFCGVVGNTTKEIGELLVLPFNTFDETN
DTTRFKQIHLIHVEAKIGNDSLEACAVSREDGFDVNIFLTKPGKLEIYVFLDGKKINEVP
YLYDVINSGFVKYL
Download sequence
Identical sequences jCVI|EIN_053760 XP_004184707.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]