SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_056570 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_056570
Domain Number 1 Region: 636-707
Classification Level Classification E-value
Superfamily E set domains 0.000048
Family E-set domains of sugar-utilizing enzymes 0.028
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_056570
Domain Number - Region: 78-124
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00295
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_056570
Sequence length 718
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_192:102536-104692(+) | length=718
Sequence
MSNQSLYLYPFCRPTPLTLPKHNYNIIFEERRNEFRTQEDLRRKKMVLMLNTPVKDVSRM
EKVKSGLSTAMVNILKSERCSECNKSINSNFVMTCECCDAILCQDCVRQKTHKERTFSLC
KYCEFIFSTVTDEIEFKQQTKDAEENPVVIFRTQIVNTCLSFMEEYLTFQLFMDKLLSMD
VPREKDVQKCEDSLKVVKAKTQKVLDLQHLVDVFDTPKKRSEATVSSNIVRSMNYFKRNI
LFESINKIKTFEKVLGQIDSVLDIDPEVLFMSSTMIPLKGGMLKVTLSSYRNIRIVVNGI
NTNFQVDGHTVLFNIPPQFRPEECVVDVKIYHKEKLVNIPGPILYFDISQKDVLVQNKKT
DDVLQKVKLIDAKKEKDIIKVISTIGNKHKIQIVECVEESESEESSDSDEDEVSVFERKD
QKGEQRETSHLQDPPKELIENNEKIPQTILNDMKMENTPKMTLREKVKSVLESDKNDEKQ
EKPQDKDICTMTPLQSKKLDVPQNTETVSTLSLAQSTPTNITTTKDQNKPLVDEKKSNMT
MFRKSRVFKLAGSNGFDYCDSTTTPTEEKRRNTTFSLFDKIHKENSDDKLPKQKVAKKKI
ENLGELKFSVQTPSTVKIKTTEGFGEALLRIDSTVEIETITPLQYSANESGLFTITGNGF
GEQPVVYIGDKQIVCYEEITPTKIVGYLPYFKLKKSLDVVVENADGVKNCKKAAITVC
Download sequence
Identical sequences A0A0A1U1Z0
jCVI|EIN_056570 XP_004185993.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]