SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_058840 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_058840
Domain Number 1 Region: 422-544
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000312
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_058840
Domain Number - Region: 173-278
Classification Level Classification E-value
Superfamily E set domains 0.0112
Family Arrestin/Vps26-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_058840
Sequence length 606
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_197:412520-414340(+) | length=606
Sequence
MKLSAVITKSGRFNEAVIGYVVLETPSPITLSYGFLEISMRCTTLKTIKEKNSFKFTYLA
STGIVPPDYLLRDMTDINAKTIDIIELIGAKSRLEKEYPPGIYTFPFSFKVPLDTPPSSL
YHEDLPKIDFSYGVTPFFVDKKKYWKGNVTLFPVVFSSPVIEKVLFTKVQNTFVMGESVV
TLLLPKKEFFIGEDIDFHLKIESRSPHENQDYIVSLIQMYNTYFLFNRNVIQTIEISGAQ
RISETKIVFHQDITLPPSLNRIDINVTYFIAIEMVPNTKEKKNTHIETLYTINILANVPD
EAQIEDHQKKSSIRFVDEKFYFPDPPQNFLCCDCGLEKVMIDGNKEVLLDHINRVVLDTT
KQNVDMRYPLLESETLPSGCVFGVYRGQRYIVDYINKKANWDLEEESLEVTQAASSDCAS
PILTIEVVESVGLCVKDSETPSTVYCAVINESGKLVKSKEVKNVDQIYENARFVIPLNPK
RKDVVVYFYHKRFLISDVFLGCVEFDLTHLKFGSNIETWFYLKGGDDGNSIVSGKALIRV
CYDSKEKKDGWDVVGELFRENFDYSLAHNREMEKAIKAQNALRQKLFAPPIYEKRGEEYF
PVNYDY
Download sequence
Identical sequences A0A0A1U0A5
XP_004254091.1.21224 jCVI|EIN_058840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]