SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_060750 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_060750
Domain Number 1 Region: 553-772
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000432
Family Quinoprotein alcohol dehydrogenase-like 0.049
Further Details:      
 
Domain Number 2 Region: 810-855
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000593
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_060750
Domain Number - Region: 98-197
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0133
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_060750
Sequence length 906
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_197:808015-810827(-) | length=906
Sequence
MGFLWLDKTKNRFGYLSKNGVNLNKNNTAVMSDKTGDADKESKKSESPGSSDDYSGKYSE
SDQSSHSSKSSSKGSTKSSEGDDDSTGTDSEGSSGGAKEMLEEIIKEYSELKRTTIFQKE
ELERKITKLNAELTEAKKMSETRKDQALRSTDALKKVIAEVVKMKEERENLVTQIEDERK
AHADTIKQLHAVQSQVNSGVGAGPSELEMTFRVLLDGSKVTDAILVKNVDSEKDDLRLQR
SLLENKIMSLGQDIVLLKQERDSNKENIKNMGEMKKSIDELMKKNSELEDEKAKLKRDNE
TLKKKGSNMPTLSFKAESTEASLKLKSAAEELDKSISLMECPTDILDLLDSVEEMMKDQV
FHRTMFNCVSTKCKSVLGAVLLSAGLTTDVAINNLYVIKSVQSEAIRSKVPTNLKVYDKI
LEEVLLFEDQFKKKAPIKIVDENYAPSLRATISGRKNRTASVYTGVNFPTPHFDKAAMPS
PGVSSKGDASSNTGEAFKAVESLEKEIKAEDDKIESKEMVCNVSNTVSHVFLVNGNIWVV
KKTEGGKSTISSYSPSFLKKETESTPVEFRITTVHVNGTHVICGGEDGLVNVYEERVSNR
LETDLTLTKRVVAIGSKPGKNTVWVLSEESLATFELAKKLKPKMFKLKLPIKGSLIQSGC
ICGKYFCVGTVFGALRTSYPPTSKSVFKQISELPSVSFGAMEAVGDSLWAVSQDKNTVFN
LHGKEVKTFNLVKPNSLTSIADDMWIGTGDGCIKAINTKSLAVTDFVCTHSQVDMVGGAV
LEIPQPNLSKVYYFFFAEGCTLRSLPTEYYNHRYNLSTDSIGRNCIVCGKIVHNGLYCSY
CPACCHTDCSDKAALDATLRLCSRDPEKKSKQTKVKVTTARSSSTSIGKPPSPLGVSKGD
NTSDSK
Download sequence
Identical sequences A0A0A1U0S6
jCVI|EIN_060750 XP_004254276.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]