SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_061040 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_061040
Domain Number 1 Region: 238-415
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.000000000209
Family Sec63 N-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 476-561
Classification Level Classification E-value
Superfamily E set domains 0.00000035
Family Sec63 C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_061040
Sequence length 563
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_197:867842-869594(-) | length=563
Sequence
MNVPYYYDTQLSIVYASYLTMTISVIMSLCFIAFYLKKGRSFPCKCRKCTKQALPNWKKP
MTLKRFVFLIFFAFMLYVTFVFNKWRIVYSTPSGFPYNPFTVLNLTTSSNLLSVEQRYYE
NTIKYMLGKMTPTHHRNYMQQTAAFALIKNEESFTQWKKQFEQPSQNVIALPFFLSPYSN
PMYFIFMAYNTIIFLVFPLLVVVLYFFLKKYQLITRERPYKQHNVKEVLDMSLTNYVSLQ
DLLNYLCHSNVITRGIDIESEDELALSILLAQLPQDSFYRIPQDLEKRSFKAYVMILCYL
TRTKMPRYMEENLARVIPLFQSEALEIVDYFYERQNLDAVVLAVRVGQMIYQACTPHTDF
FQLPDFETNQIPLMKKITTVSLSTLQPFERQQKLQEICSSSTQLALWKNYLMFFPGNLEV
DMSNVDIYRLVPTDTLNYVVDVEIIIRRPPIFFEYTQFFDKETNKLVGTQEIPVEYSDVP
VHTPYTGKNTLERFFLFVEIEGTTVAFHKKVLNIPFSASPIKVVFSTHIHSGVSTIKFWA
YLVSECYIGCEYCLKKTVKLVEA
Download sequence
Identical sequences A0A0A1U0V2
jCVI|EIN_061040 XP_004254306.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]