SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_067260 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_067260
Domain Number 1 Region: 92-201
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000186
Family Myosin rod fragments 0.0088
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_067260
Domain Number - Region: 342-557
Classification Level Classification E-value
Superfamily Tropomyosin 0.00216
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_067260
Sequence length 585
Comment | organism=Entamoeba_invadens_IP1 | product=coiled-coil domain-containing protein, putative | location=EINV_229:34496-36531(+) | length=585
Sequence
MKVEAANEKLRITKTELGRTKAELDQLQQNFDYLKNNADTDAVDKKKLNKTVNESNKKIE
ELCAKVDELSDVITRRGQEVAEANEEYEIVKKDKFVKEKEAKKLKAENDEIKEEVKNLAN
DKDQLSSEKKKLQDQYDQLINLVSGHEDETNNLNGSIKRLQRHLEANNSELIELRDRTAK
DKKKIANLEQQIQDLEERPVETSNIDQTEVIKRDNQIADLEKAVAALKDQNTQLDAIKAH
EAQKKMALDDKADDEKTAADQSDRRKKMEDQVKAHNAQVSSFKVQISAPASVVQEEEKNM
LNARIAGIQTQLDEERQKVYSADAARKAAESKLLETNELTVQVHQLTEEKKKKKKNENDL
EEMDKMINDLNAEVDMAQRQLDTANDDRDYEKDIAKITVKAETIEKNVQMAEQEKVKTMR
NIKTVSEELMRTKTELDEKQDECDKLEDDLSEMKTELEALEQAAKTYKQSKNTYEKKLTE
LNEQLDLERTTDQQAKAQKKKYVDKLREVMENENEFGEYKEQAEKSIHSLIAQKADLQKE
LEKERAMKQEVDKEIQRLGAKVIDSEAKLVDAGATGASIAKLKAK
Download sequence
Identical sequences A0A0A1U746
XP_004256997.1.21224 jCVI|EIN_067260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]