SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_073170 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_073170
Domain Number - Region: 28-68
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0458
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_073170
Sequence length 135
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_257:318388-319010(-) | length=135
Sequence
MVNDFYKKARSIRDNHHHINIQVYFINFIALKFELVMKLNELRDRTTKNKKKIVDLEQQF
QDPKDKVGTSNIDQTEVIKRDFQIADLEKMVAALKDQNTQLDAANKDIKKQLKTLRRLRI
INHRLRHLKHKRRRL
Download sequence
Identical sequences L7FQ10
XP_004259061.1.21224 jCVI|EIN_073170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]