SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_084270 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_084270
Domain Number - Region: 266-377
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000523
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 440-486
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0327
Family HSP40/DnaJ peptide-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_084270
Sequence length 556
Comment | organism=Entamoeba_invadens_IP1 | product=paramyosin, putative | location=EINV_314:240104-241774(+) | length=556
Sequence
MLKHTQSEHTPKVAKSEQKMEKQEKEIKGGIEKGEEMTKLFESKTDKTKDQQQEGEKEET
QMMIKKLEEEKQQLAIKIDEIEHNKNELLMKVDELQKEKDEQMVNTQKEKEVIEKKVGEF
ENQIKLLQKKVENLEHDKKLLINQIEEVKNEKELLQKKLEEQQTLHEQTESERIASLKEN
SKQQICRLEQQVESEKKEKTKQIEFNQTIQKERDVLMDKNKDLTHKITEADKNIQIFKFQ
IDEFQMKIKELSGKKDENGDKENMYRKEVEKMQQTIETYQLEIQKLKEEAEKQNYTINTL
SKENLKMLNKITYEFQEKYNLNLTISGLRKEKGELHNRCDQLKTDKEEMELTIDDMYNEC
YRLNGEIEKHKKQIEELKEQVESEKKEKTKQIELNQKIGKERDILTNTNKNLTQKMRDEE
VKKYNDLVNSEDTQKMHSNEIYLTIEEVYSGCQKMITTHSSKGTEVVVLVILDKGIKEGE
VIEIDNVNYVVKYIEHPYLSRRGDDLVVNKSVFITNGVRHPASSRVLMKNECQTLLSLKG
FTEQGKTLFDDGSVTC
Download sequence
Identical sequences A0A0A1TXG2
jCVI|EIN_084270 XP_004185324.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]