SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_088980 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_088980
Domain Number - Region: 6-63
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_088980
Sequence length 107
Comment | is_pseudo=true | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_329:13859-14182(+) | length=107
Sequence
MENENEFGEYKEQAEKSINSLTAQKADLQKELEKERAMKQEADKETQKLRAKVTDSEAKL
ADAGATGASIAKLKAKQKRKKHKTQLLKLRNKLNSKPERLKRLRESL
Download sequence
Identical sequences jCVI|EIN_088980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]