SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_090080 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_090080
Domain Number - Region: 32-103
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00149
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_090080
Sequence length 109
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_331:3856-4185(+) | length=109
Sequence
MRRKTTLLIWRNKSRSCKTPFLMSTHRKKTPELFDDLANIKNDLKKTQFALDDTEKKLYK
QIAQNKKVSDERDGYNQQLQAEKTKTAALTSAKNANDKKILSLNQRKTN
Download sequence
Identical sequences L7FLS1
jCVI|EIN_090080 XP_004255846.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]