SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_093380 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_093380
Domain Number - Region: 460-552
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00034
Family Myosin rod fragments 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_093380
Sequence length 613
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_335:322171-324012(-) | length=613
Sequence
MDPTEALLVEVHNLQEELSFLRKKVETVQLDNYDARLTTIQIEMSKKTKDYEELEAKFVQ
ALNRQSVLAQEKLLFESKEQNLIVEYKTKLQDLQNYCDHLKHKRNKKHSKEKKSLFQKVL
DVTEGPKNKVEKVEKHVEKVKEKNEKFEKTTKVPLVVPKNVTPPVSQNESIKQSDQIKSE
TPNLASTNPFADLTVEPQIKQNQELPAVLQTDLKKSETKQDGIGPNLASTNPFADTNGFT
QVEPLKEQLPKLDVAPQYSLNPFSDTQNLPQTTESGVDIQKEIKHARQSETPNMNSTNPF
ADVTVAQDKSAPKFENLENTNPFAEPNISSSTPIDSSHQKKESKDSVVTTNLVTDQSLVS
KSTPLTPIEKVGTPKKSRTPDKSPSKLLKAKKSVVVLKETTLVKSEIIGPSQNEIVEQMP
VLKSFPVEKPQVVIHNEFEDFQVSSSSSSSSSSSDSEDTPTFNIEKLSSDNIELKKETVE
LKKKIEECEKKYLDYSNVMSKALDDKTLIVQTLQSRIFELENEKKALEFKHHQLENRIEE
YTKSTSDEVEDNNMYLLVNGICVSLKLANPDFEDTTLSVATLNQKVKERKIPMCQWPLFI
YNEFENEVGKSKV
Download sequence
Identical sequences A0A0A1UEM8
jCVI|EIN_093380 XP_004258057.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]