SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_094170 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_094170
Domain Number 1 Region: 65-500
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.36e-99
Family Leishmanolysin 0.0000229
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_094170
Domain Number - Region: 500-568
Classification Level Classification E-value
Superfamily E set domains 0.00332
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_094170
Sequence length 647
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_335:498478-500421(-) | length=647
Sequence
MLFFILYATAVYSYDCIYSQIQAQTEETLYTLDDTLKQQFKAEGEWTPLIVKFDMGALDG
IYTSNPAVCLTEGGGCSKENVLTTEKKDYIKSMVESVQNYLNKYFQVHPGTIQILQDNYK
KRVSCGEVSDIKDQVVDSDVGMIMYVTSHPVESPTILAYAASCGSADDYLGLNNGRMKKR
SIFGYTNINPANLDTTPGKFRINVHTFLHETLHALGFSSSTGTRKVSKGKGEETVSVIDT
PNVLRVAKDYFNDQTIEYVEFEDGGGSGTAGAHWEKRVLYNEIMTGTSSMYSSLSNFTLA
YFEDLGTFKPNYSVAEPLTWGKGMKKDFFKCSNWPEKAPYYGKNQNRGCTPDRGAVGICD
ATTHTSPGLDPIYQNYGDPNRGGMVELMDYCIHTTLVSGGQCYAQDMLSLETVSSLSFLD
RGSSFGQDARCFTTSLMKYSVPIPDFSCYRVKCVERGYRVRVNNNWMLCSGEEELSVAGY
AGKITCVNKDEFCNGEVEEWPDIWKLTPAKVKSGNEVSLIGKYLKDVYKVYVSSTEQTII
STTDQELVFKLEFTDAVVNIIELLQNGYVTVEVKVVSGEDVNAVYQGFQVEMDLKEVANN
FGQWLYKNIFFTVGIVIIFLFIVNLFIYIIAKRIVYRRAKQIARNLI
Download sequence
Identical sequences A0A0A1U962
XP_004258138.1.21224 jCVI|EIN_094170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]