SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_095120 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_095120
Domain Number - Region: 197-239
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_095120
Sequence length 442
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_335:702292-703806(-) | length=442
Sequence
MELSCCLCNCPIVLEEKLSLLNSNTNSESRTPLKTPEKTPEKLSPLITPRTIALGGQLLL
STPLPLPVKQNNLKMNNIINSDNSDTNDSTPETSGLSLSPPEILYTSPKYFERRGSLGRS
FTKAIFKAKRKQCEHLLISPPTTEFFQWFTLMNEKYGEFKIPCAQCYEDVMESYKIDLES
ASHNIEMYQMTSCELFKNMIGVQDETETAETAVKMLEAEISTLERVNAQLVEEKRTLTQW
SNRVNSHIKDSFLNEAKILDFTHNAKLSLFLQQTGLNDFSSVPLQKSIAWAQVFKKENIV
PQTQTICLITRMRQKPINAILGIILTQLKVLASMLKYTYTTVTFKQNTPNKEVFLIDPKE
FQTTNKKYLKCVLQHFLAMLNEIQTVLYEESSNVFFLIYNITSDSINGIDFLGYDAKKWP
LALDSFLSNTEHCFKWIYKHYK
Download sequence
Identical sequences A0A0A1U947
jCVI|EIN_095120 XP_004258231.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]