SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_095130 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_095130
Domain Number 1 Region: 404-534
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-16
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_095130
Domain Number - Region: 14-132
Classification Level Classification E-value
Superfamily E set domains 0.00644
Family Arrestin/Vps26-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_095130
Sequence length 607
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_335:704088-705911(-) | length=607
Sequence
MQKVSILLAQYGTAGEPMIGCVKATFTQPIFLQKVYIGLQQINMKYGCVENSLPKKETDV
ESTGLSVPSVYRDEFTVAMFECDGNYPLGEIEFCPGTYQFPFNFTLPPTFPPTLIIPGKP
YQTTYTLKALFIYDDNKRYESGSVDFPILYNCDIPLEIPTSTTKPIGKLIVTVAQNRSSY
IQGENMDVALSINSLENTQITLSLIGAFLSGSVCQKVTYNSMEMKVERNVPISNLSIIFP
ISYTTNPTYVTSSQAFRHFISIKIESSNIFSNPEEICFPVKIIARRPSDDKVQLYSKFLG
VVINPYVHPSFCEGRLEQPPQYPITVQDGVEKIQTTKGQVLFLDHKTRNVLSEKQGEPVQ
MCVYPLWKSSLLPPGITYGMWRNKECVFDHINKKTFWVDPFVNLPQSLLNDSPNAFVSIF
VVEALGLRVRGSTNPPTVYAAVFNSYGKMMKSKEVKNTPDPIFNNASFVVNPTTRRKNVI
VYLFEKRSLVSDDFIGAADIDLTKLPFPSFIDQWFTLHDSPFGNECITGKVHLKIGYDRI
PHKIGDECKEIIQFSSLCDVPFYPPTEDMKKQVTTQNQYRSKQLMQSYMAVGNMGCMNCD
WDVSKIV
Download sequence
Identical sequences A0A0A1UF78
jCVI|EIN_095130 XP_004258232.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]