SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_098700 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_098700
Domain Number 1 Region: 136-238
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000602
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_098700
Sequence length 254
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_354:13033-13960(+) | length=254
Sequence
MNRLLLLSFKTPSTLGTNSEIGSGLDCSKRSDQHLREEDLMSKKLAEEIAKREAAEKALA
EMKIKKVDLEALVQKLKDEIEELKEDIESKKIALDEADIKSREDQEHIEELQGDIKRGKE
DLSKLTTDVITELNKNIEDKEGEISDLKKKLEAKEDNSKDLETQLRVKEDNIADLEKHVK
MLQNTISDVNAQNEDTGSTQLALDDAEKKLDQQVAPNKNVSDDRDGYNQQLQAEKTKTTA
LTSARMQMIRIFLL
Download sequence
Identical sequences A0A0A1TYI2
XP_004185879.1.21224 jCVI|EIN_098700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]