SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_098710 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_098710
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000471
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_098710
Sequence length 157
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_354:14339-14812(+) | length=157
Sequence
MKEKKLLLTKKLKAENNEIKEKVKNLANDRDQLSSEKKKLQDKYDQLNNLVSGHEDETNN
LNGSIKKLQRDLEANNTELTELRDRTAKDKKKIVDLEQKVQDLEDRQVGTSNIDQTEVIK
RDNQIADLEKAVAALKDQNTQLDAVKKDIKSGQLKTL
Download sequence
Identical sequences A0A0A1TYG7
XP_004185880.1.21224 jCVI|EIN_098710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]