SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_101600 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_101600
Domain Number 1 Region: 7-173
Classification Level Classification E-value
Superfamily E set domains 6.3e-45
Family RhoGDI-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_101600
Sequence length 174
Comment | organism=Entamoeba_invadens_IP1 | product=Rho GDP-dissociation inhibitor, putative | location=EINV_358:113469-113993(+) | length=174
Sequence
MSATDIAKNEKDPSLVAYLKSLGMDPDYVPPKDDPRRVVISEFAVLFKTRDPVILKLSTE
ADIAKAKSTPIPIKENEEFKMRVSFRVQHEPVLGLRIINTVSKLGKQVASDEEMLGSYPP
KNEFQALELPKNDWNEAPSGMLARGEYKSNVKFTDDDKQMYLQFDYLIKIVKEL
Download sequence
Identical sequences A0A0A1UA88
jCVI|EIN_101600 XP_004255830.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]