SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_106100 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_106100
Domain Number - Region: 50-88
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_106100
Sequence length 145
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_362:708137-708574(-) | length=145
Sequence
MEQAKSYCIFCYAPLDDEVPLCQTCLVMQLKMKEVICESLQSACVSSVMEIQTLSLEQKS
INELIRKEEEAVTKLETEIKKLQNTNDALNCSFEFLKVANRKQYSTEDLLFDIISELAAG
SYTCLDNYNNSITKLVYRYDLDYGV
Download sequence
Identical sequences A0A0A1TYS5
XP_004184071.1.21224 jCVI|EIN_106100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]