SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_108260 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_108260
Domain Number - Region: 8-61
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_108260
Sequence length 103
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_373:243917-244291(-) | length=103
Sequence
MKNLAYDKDQLSSEKKKLQYEYDQFINLVFGHEDETNNLNGSIKKLQRDLEANNTELRDR
TTKSYEKDIAEITFRAVTFEKKVQMAEQENVETVRDYKTASEE
Download sequence
Identical sequences XP_004260620.1.21224 jCVI|EIN_108260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]