SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_108280 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_108280
Domain Number - Region: 9-93
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000209
Family PspA lactotransferrin-binding region 0.0049
Further Details:      
 
Domain Number - Region: 72-153
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0178
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_108280
Sequence length 157
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_373:245020-245676(-) | length=157
Sequence
MRLKSQEDQEHIEEYQGDKKLEAKEDNSKYLETQLHEKKDDIADLEKQVKKLQNTISDVN
AQNEDTGAVLNDTKDDLANTKNDLKKTQFALDDTEKKLDQQVIQNKKVSDERDGYNQQLQ
AGKTKTAALTSAKNASDKKIFALNSEKDELEDKNRKT
Download sequence
Identical sequences XP_004260622.1.21224 jCVI|EIN_108280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]