SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_109840 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_109840
Domain Number 1 Region: 417-685
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-78
Family Protein kinases, catalytic subunit 0.0000511
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_109840
Domain Number - Region: 175-221
Classification Level Classification E-value
Superfamily E set domains 0.000196
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_109840
Sequence length 708
Comment | organism=Entamoeba_invadens_IP1 | product=map3k delta-1 protein kinase, putative | location=EINV_373:632211-634337(+) | length=708
Sequence
MVKTEVLLFLLLTCSYSFSTVFNFSSTTATKECDIEKCKKINNQCFCSDTMECSNKEDSA
MFKDLVFEFYLPPRAFINNQVIKLNVSTIFDLYSPPPKFALYVNNSPKPFVMSLDIWNDE
EVACTQTKMILLNSLSNFGSILNGTNELRIVSYSNIFCVSRIEVNVSYDILNPVIKKINP
PLGPTHGGTVVNLSAAFLYPEYEYMCCFGTDCVNLTKLTFGPINTGYDYDDMDVLEMTNK
EIANRNDLEFGFGRCISPSGSNGSVVLNVSFADFDVERTYLNPNNASFTFYNLIIKDIDL
TINAGECYAVVVVEGVVSSETSFCLMRSESSNETKKYRGSVYDASVLCRLEGFDLEQEVG
NVYSFSVTINGLDYTDEVDYTVKQPGDVSNDKGFIVIVVFIIFGIVLIVVVIGFLIYNKL
KNKTDDEEYISAEDVVLGDLLGSGSYGNVYSALWRGQEIAVKLIPTKDMLQDNVLQFTKE
VQLMKKLRHPCVLQFFGSGTDANYILIAMELMSRGSAHTLLINSHLTMSWDRRLRMLKDA
ASGMFYLHSSTPPIIHRDLKSHNLLVDENWKVKVSDFGLSKTTVEASMPDEICGTLAWMA
PEILMRKGQTTKSDVYSFAIVMWEFLARKEPYPDIPRFHLIEKVGEIGLRPDIPPNNHIT
YCELMQRCWEQDPNLRPDFSEIIHLLDDFIKEEPEQSVISDSPSIFEE
Download sequence
Identical sequences jCVI|EIN_109840 XP_004260774.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]