SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_113930 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_113930
Domain Number 1 Region: 9-121
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000188
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_113930
Sequence length 165
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_375:38484-38981(-) | length=165
Sequence
MKTELEATLKQAAKTYKQSKNTYEKELTKLNEQLDLEKTTAQQTKAQKKKFAEKLREVME
NENEFGEYKEQAEKSINSLTDQKAELQKELEKKRAMKQKLTKKTQRLRAKVTDSEAKLAE
TAATGASIAKLKAKQKRKKHKTQLLKLRNKLNSIPERLKRLRESL
Download sequence
Identical sequences L7FN09
XP_004259179.1.21224 jCVI|EIN_113930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]