SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_113950 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_113950
Domain Number - Region: 111-228
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000863
Family Myosin rod fragments 0.0035
Further Details:      
 
Domain Number - Region: 36-87
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0549
Family Motor proteins 0.0041
Further Details:      
 
Domain Number - Region: 183-323
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0863
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_113950
Sequence length 343
Comment | organism=Entamoeba_invadens_IP1 | product=myosin-6, putative | location=EINV_375:39708-40782(-) | length=343
Sequence
MTASGVTSDAIPVVKDLMKQICEKYKKDGKPRVYTVEFRFGKIKIFFKVGVLAEIEEIRE
NRVTELVGGLHMCAKAFAQRKLIEQKRNEHIAITAMKTPFTLGTNSEIGRRFDEELAAKD
KEIETVKKKLAEEIAKREAAEKALSEMKIKNVDLEALVQEFKKDIESKKIALDKADMKSR
KDQKHIEELQGNIKRGMEDLSKLTNEYKKLEADNQRLQDEITEHKATIAKKDCVITELNK
DIEDEEGEISDLKKKLVAEGDNSKDLETQLRMKRDNKIVDLEKAVAALKDQNTQLDAAKK
DIKKWSVEDASKIENNKSHIKALEVQKKMALDDKAEAEKTTAD
Download sequence
Identical sequences L7FNR3
jCVI|EIN_113950 XP_004259180.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]