SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_119620 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_119620
Domain Number 1 Region: 134-244
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000233
Family Myosin rod fragments 0.0023
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_119620
Domain Number - Region: 337-453
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_119620
Sequence length 458
Comment | organism=Entamoeba_invadens_IP1 | product=neurofilament medium polypeptide, putative | location=EINV_397:58863-60502(+) | length=458
Sequence
MLVVKDLMKQICEKYKKDGKAKVNTEEFRFGKIKIFSKVGVLAEIEEIRENRDTELVGGL
HMCAKAISQRKLIEQIAINVIQDTIHIWYQFRNWFRLFKRTKKLKLLKKKLAVEIAKREA
AEKAFAEMKIKNVDLETLVQKLKEDIESKKIALDEADMKSQEDQEHIEELQVDNQGLQDK
ITEHKATVAKKDSVITVLNKDIEDKEGEISDLKKKLEAEEDNLKDLETQLHEKEDDIADL
EKAVAVLKDQNTQLDAAKKEMKKSSVEDASKIENYESQIKALEAQKKMALDDKAEAEKTA
ADQSDRRKKMEDQVKALNPQVSSLKKADSADAVRKTDSQKELEKERAMKQEADKETQRLG
AKVTDSEAKLADAELEGIETEKEEAQNTAAKAKKQAKQYARKVEEAERKLAEFEQKESTF
NTQIGKTQSDLKKTQQSVRDGELRTAELEDISENLVNI
Download sequence
Identical sequences A0A0A1U645
jCVI|EIN_119620 XP_004256609.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]