SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_128010 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_128010
Domain Number - Region: 58-161
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0068
Family Myosin rod fragments 0.0064
Further Details:      
 
Domain Number - Region: 175-362
Classification Level Classification E-value
Superfamily Tropomyosin 0.0131
Family Tropomyosin 0.0063
Further Details:      
 
Domain Number - Region: 344-538
Classification Level Classification E-value
Superfamily Tropomyosin 0.017
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_128010
Sequence length 673
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_435:92200-94221(-) | length=673
Sequence
MSLSSLMFNHDKDGDIRRLETELTSKQKEIDTLNKDKQNFIDDIKQLQKTQIFNENTICK
KSKEIQQTVNDLNEILGDLKKSCDLVEQLNKEIEKLKEETESLKSQLQSEKDRADGLDKK
LTDEKTRTDDLDKKLQSEKDRADENTTKYTSEKDRADGLDKVLTSERTNFKFEKMQLEKR
NKDYEETIDGKSKEIQQIQNDLIKTKEDLKESNNLVEQLKKEIKKLTEEIEKIKKENHSW
SIFSNKNKKEIEKMKEEIENLKSQLQSEKDRADDLDKKLTDEKDRADDIDKVLTCKINKL
KTEKVQLEEKDKTLEKRNKNLEDIIKQHQNSCKSFVESSNVIVQKMKDEITQITNEKNEL
NIKNSELVLENTDLRKGFNDSISKIEQQQNKENEWKKNFIVLNNQQLEDSRNKEKRITSL
ENDNNELEKKHEGVLKQVEELERIKDNYINANTDIEERLNKNEKKMKEMKSERDCDKSTI
TKLEKENKECLIKVETLEREVEVYKQKVKESQEELETVKETQSQQSHTKENVIEKEKEEI
TRLEIPMAMFHFGGTFTHIIGEKPVEMTIEAGTAEPHTITYEKDGVQHTFQISSQKVEGT
EKRGFDLIKTVWVEKQYVGQSVTIPINIDILSENYNVPIVVPDTPTSFNLGELGFFNKET
QKRGNLVMVLEIV
Download sequence
Identical sequences A0A0A1TX85
jCVI|EIN_128010 XP_004183432.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]