SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_138450 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_138450
Domain Number 1 Region: 23-226
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000719
Family Tropomyosin 0.0014
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_138450
Domain Number - Region: 253-348
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0256
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_138450
Sequence length 356
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_465:50297-51472(-) | length=356
Sequence
MQELLKFKPNPMKKDRMLTEVQFNLDEANNTKEKLTKKANDLSVQVDQLTNEKKKNEKDL
EEMDKMINDLNAEVDNAQKQLDTANDDKDGNEAMKQKYKDELMSVRTELDQEKKDHSKTQ
LMKGKYEKDIAEITVRAETLEKKVQMAEQEKVKTLRDNKAASEELMRTKTELDEKQDECD
KLEDDMSEMKTELEALEQAAKTYKQSKNTYEKKLTELNEQLDLERITAQQAKAQKKSNAD
KLREVKTNSKELEKERAMKQEADKETQKLRAKVTDSEAKLVDASATGASIAKLKAKYETE
LEGIETEKEEAQNAAAKAKKQAKQYAKKVEEAERKLAEFEQKESTFNTHIGKTQAV
Download sequence
Identical sequences L7FMK7
jCVI|EIN_138450 XP_004258553.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]