SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_138470 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_138470
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000034
Family Myosin rod fragments 0.0028
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_138470
Domain Number - Region: 89-174
Classification Level Classification E-value
Superfamily Prefoldin 0.00602
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_138470
Sequence length 190
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein, conserved | location=EINV_465:52713-53437(-) | length=190
Sequence
MKSREEQEHIEELQGDIKRGKEDLSKLTTEYKILEADNQKLQDGITVHKATIASRDSVIT
ELNKNIKDKEGEISDLKKKLVAEEDNSKDLETQLHEKEDDIADLEKQVKKLQNTISDVNA
QNENTGSTKTAVLTLAKNASDKKISLLDSEKDELEDKNRKLAKLTKRIEDGLNDSDMLKA
QKADYEKSKF
Download sequence
Identical sequences L7FPQ4
jCVI|EIN_138470 XP_004258555.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]