SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_144310 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_144310
Domain Number 1 Region: 7-108
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000107
Family Myosin rod fragments 0.0039
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_144310
Domain Number - Region: 113-224
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.016
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_144310
Sequence length 336
Comment | organism=Entamoeba_invadens_IP1 | product=M protein, serotype 12 precursor, putative | location=EINV_487:65359-66566(+) | length=336
Sequence
MKSREEQEHIEELQGDIKRGKEDLSKLTTEYKKLEADNQRLQDEITEHRATIAKRDSVIT
ELNKDIEDMESEISDLKNKLEAEEDNSNDLETQLRVKEDDIADSRRRLPNATKIEDYEPQ
IKALEAQKKMALDDKAEAEKTAADQSDRRWKTKRENMLNSRIAEIQTQLDEERQKSDRAD
AARKDAESKLQEVQCNLDEANNTKEKLTKKAKDLTVQVDQLTEDKKKNDNDLEEMDKMTN
DLNAEVDKSQKQLDTANDDKDGNEAMKQKYQDELSSYEKDIAEITLRAETPEKNVQMAEQ
EKTMRDYKAASEELMKTKTELDDKQEDMRQTRRQIV
Download sequence
Identical sequences A0A0A1TZI2
jCVI|EIN_144310 XP_004183305.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]