SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_146890 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_146890
Domain Number 1 Region: 421-536
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000109
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Domain Number 2 Region: 371-408
Classification Level Classification E-value
Superfamily WW domain 0.000015
Family WW domain 0.0037
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_146890
Domain Number - Region: 156-236
Classification Level Classification E-value
Superfamily E set domains 0.00175
Family Arrestin/Vps26-like 0.015
Further Details:      
 
Domain Number - Region: 14-115
Classification Level Classification E-value
Superfamily E set domains 0.0203
Family Arrestin/Vps26-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_146890
Sequence length 776
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_495:198239-200569(-) | length=776
Sequence
MKIDIVLCNKGVVGEPVNGFIEAVFKSPKFIKKVSVIFQTHTNYPDFKNGYSSDPRQDSN
ASEWQEKNMKEDFGFQSFTCNCFSEHYNIQNGRFTEYPEGIARFPFEMVLPQKCCTTVVM
GKCFLKWEMVAQIEELSCKIHKSDVFELPLLYKLYTTEIVKTQTSECIDNKRFSLKVELE
KNEYTQGEMVNGVIDFSNKTNTVLSLKISNQSVVESTKIDNSAIDKRVYIEQNFEVLLGI
SKMRFSLQVSPQQLASVIADPLSLRNFLVVRVDGLKNLTSVESGVAVPIVVRPSCPYNRK
NMEEYAKELGYDISFKKKRFYGTHKVSPPTIDIQNGLESGRVVDTNQVIYLDHYSRLVFE
DKDKKTVMKRAYPTENMNLPVGWAMGYFRNERYFFNVKTLMSTWIDPRENPLPEHVGDEV
TGTLTICPTQCEGLIGSKGIELCVYSGKKKMKVVSNKGLDPTFNKNDVFKINLDKMRNNV
LLYVTDGKSTIGVIEFDLTLLKYYTCVKKWYYLHSPEHQRTEYMGRILMEVTYATSTDKP
EIRNIVDYFSALNLLFYPSSKKFIDVVQSTNEERTKEKLPKLMDVYDQKYVVINREAFMN
YFIFDDLKDEFVFTKTKEDEKDKLKVENKRKAYVEIYGKIVATTYEVGEGEESYDVSQDV
EKPKKKFSLSLSGSLSRSRSTSKPKESTPKRLETLTPTFSPRTKKYRKEGEGAFGLLSSC
DFPRDMGETAETKKESASSSEILKPVFGRRNAGKKHFVDISKESATQTNNFGALLD
Download sequence
Identical sequences A0A0A1UE16
XP_004261622.1.21224 jCVI|EIN_146890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]