SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_149220 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_149220
Domain Number 1 Region: 395-514
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000748
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 
Weak hits

Sequence:  jCVI|EIN_149220
Domain Number - Region: 12-131
Classification Level Classification E-value
Superfamily E set domains 0.0231
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_149220
Sequence length 588
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_495:710169-711935(-) | length=588
Sequence
MNVEIELIKYGFAGEETNGYVYMTVKKPTILNMGFVSLSQIDVLGYGNNSACTRSSSHTF
SNTISNYPQKIQSQINMFPINISSVGKEFPPGKHRLDFSFYLPQNFPTSYVTQCQSLSYS
LQAQMFTSDGKNFSSEEVEFPVLYNHALISSLPLTVSGIINNLFVTIHATQTTLSRGENA
VVYLSVSNLSSDINRTLRILLISECNDGSDVTIETLNEVSFELTQSELVNQQVVFPIDQK
TCPSTVTPTNSLRHYIVVKMDNLKFTEKNELLALPLSISADAQNVVVEENKGKSVEIKPT
YTMFPNVDSVMVSPGIEHLKTTNNSDMFVDHMRRLVCDANGKAIDGIYPFYESTTLKPGC
TFGILHNRDCVINHTTKEVMWFKDDLLPQALLQQCENAVVTIQVLEAEGLNVRSAKNVPK
VYCCVTTTPWKKSKEVQGICPAFDDTMFFIDVGNNRKNVILYLYDNSSILGDDLLGFVNI
DLTKMPFPCAIEGWFEFRNSPLGEETYTGRVKLRIAYDKVRHSAGDVYVHIPDVISCFTK
PIYSNSTKMQKQVKNASALCSQAGATPYCSITSNGSVVNKFEQLYQSL
Download sequence
Identical sequences A0A0A1UEU5
jCVI|EIN_149220 XP_004261861.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]