SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_156600 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jCVI|EIN_156600
Domain Number - Region: 155-220
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_156600
Sequence length 433
Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_524:48701-50002(+) | length=433
Sequence
MTKVSQQKQPTEPTGTIPPPPTEQQPQYPGVMHVTGSIVISQLFNNGVINFTGTTSDQKG
VSQQPQIEVKTHSSQVVKENGKPGVSTEGQSSSISPDDKRSEGVRNRCTEKYERSLGEFT
ESDGCGNDENSIVRGQSEKKSDNSLSDPELSTVTTILKSMESDLKELIIKEKTITETVNQ
LTESKKTLKSPSQVQDLHEQVESNEKMLERVSSEFGRLKQFSTSMSEMVRPSASVVIRPT
ITVPQKLPSLEEMVVEPVIGQLKFQKKIVEWTNMCQYRVLYRSTKDNLTAKALNAKICGR
TNILLIVITNKNYVFGSYSSVAIPNPPKIGDHHVGPDNAFFCFTFQNPFNTEPLKITKKT
TSTSLKIYSNKEQSYVVGVDACFYIRANCPSHVPSCFAESFDDPTKKGGLLFVNAVYPDK
FGVQELMAVELSN
Download sequence
Identical sequences A0A0A1U7X2
XP_004257800.1.21224 jCVI|EIN_156600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]