SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EIN_157060 from Entamoeba invadens 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EIN_157060
Domain Number 1 Region: 231-409
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.44e-41
Family Sec63 N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.77e-33
Family Tandem AAA-ATPase domain 0.00047
Further Details:      
 
Domain Number 3 Region: 427-518
Classification Level Classification E-value
Superfamily E set domains 5.88e-17
Family Sec63 C-terminal domain-like 0.00091
Further Details:      
 
Domain Number 4 Region: 117-214
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000762
Family RecQ helicase DNA-binding domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EIN_157060
Sequence length 520
Comment | organism=Entamoeba_invadens_IP1 | product=activating signal cointegrator 1 complex subunit 3, helc1, putative | location=EINV_524:147286-148848(-) | length=520
Sequence
MLRESLPYGIGMHHAGLNEKDRDLVEDLFKSNKIQILITTATLAWGVNLPAHLVIIKGTE
YFDGKKHQFVDMPLTDILQMMGRAGRPQFDNEGVAVILTYEPKKDFLKKFLFEPFPLESY
FENVIADQLNAEIAVGNVTCLKDAVKFLTYTYYFRRLLKNPNYYGYDGKIQIGKFLVSKV
LTAIEQLVSAKCITYEDGELQATSIGKVGTMYYISYLTIKMFAVRMRKNLSHQEIIQIIA
DAAEYNNHPVRHEDDNHCRTLSKSVRYGSVKGSFDDPHTKVFLLLSAYFGDNTLPIVDFV
LDTKSVLDQAIRIVQAFIDIVAEKGYTDVVVRAIEVLQMIGSGRWVFESPLLTLAGVSQK
NVVKFERQNLRYLPQFFGMEQSALTKACKTAGLNSKQTDQIRTQIAKLPRVDVKLIVPEK
VEICDEIFDISINLVRQNQGSNYAFLPRFPKMKQEGWYVIVLRPDGSLAALKKVGIKKAT
NVTLMCVCPVITGTFNFKVLLLSDCYLGLDQQYELPVTFV
Download sequence
Identical sequences A0A0A1UE46
jCVI|EIN_157060 XP_004257846.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]